PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G10570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 191aa    MW: 21776.9 Da    PI: 9.1742
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G10570.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.37.3e-272372251
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  rie+ + rqvtfskRr+g+lKKA+ELSvLCdaeva+++fs++g+++ ++s
  OB06G10570.1 23 RIEDATSRQVTFSKRRKGLLKKASELSVLCDAEVALLVFSPRGRFFHFAS 72
                  8*********************************************9986 PP

2K-box63.76.7e-2296188698
         K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                    k+l +a+ ++++  ++ L  ei++ +   R+++GedLes+sl+eL+ Le qLeksl++iR +K++ ++++i +lq++ek l e+n +L +k 
  OB06G10570.1  96 PKELITAQVQNMESRAETLAMEIDTVEAYTRKMQGEDLESCSLQELNDLEMQLEKSLSSIRVHKQKKMMDKILQLQQQEKILLEQNAQLLRKQ 188
                   45577899*********************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.0531474IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-301673IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-251636IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001670IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.03E-271795IPR002100Transcription factor, MADS-box
PfamPF003198.8E-262370IPR002100Transcription factor, MADS-box
CDDcd002651.75E-322487No hitNo description
PRINTSPR004045.7E-253651IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-255172IPR002100Transcription factor, MADS-box
PfamPF014861.4E-20103187IPR002487Transcription factor, K-box
PROSITE profilePS5129712.42104191IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MEAAAATEGG GQQRRGGRRE VRRIEDATSR QVTFSKRRKG LLKKASELSV LCDAEVALLV  60
FSPRGRFFHF ASAPSLEETI DRYISHSQET PANKKPKELI TAQVQNMESR AETLAMEIDT  120
VEAYTRKMQG EDLESCSLQE LNDLEMQLEK SLSSIRVHKQ KKMMDKILQL QQQEKILLEQ  180
NAQLLRKQQV S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D9e-161786171Myocyte-specific enhancer factor 2A
3mu6_C9e-161786171Myocyte-specific enhancer factor 2A
3mu6_B9e-161786171Myocyte-specific enhancer factor 2A
3mu6_A9e-161786171Myocyte-specific enhancer factor 2A
1tqe_S1e-151788274Myocyte-specific enhancer factor 2B
1tqe_R1e-151788274Myocyte-specific enhancer factor 2B
1tqe_Q1e-151788274Myocyte-specific enhancer factor 2B
1tqe_P1e-151788274Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2410558e-95AK241055.1 Oryza sativa Japonica Group cDNA, clone: J065063N18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015693944.11e-117PREDICTED: MADS-box transcription factor 50-like isoform X1
RefseqXP_015693945.11e-117PREDICTED: MADS-box transcription factor 50-like isoform X2
SwissprotA2Z9Q71e-53MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLJ3MAL31e-138J3MAL3_ORYBR; Uncharacterized protein
STRINGOB06G10570.11e-137(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP174341010
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.16e-42AGAMOUS-like 20